PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000812154
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 297aa    MW: 33448.7 Da    PI: 7.2303
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000812154genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding32.52e-102361448
                     HHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding 14 davkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     ++++ +G g+W++ a + g++Rt+k+c++rw++yl
    MDP0000812154  2 NYIANHGEGRWNSLAGCAGLKRTGKSCRLRWLNYL 36
                     57899****************************97 PP

2Myb_DNA-binding51.42.4e-164285146
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                     rg+ T eE++l+++++ ++G++ W++Ia++++ gRt++++k++w++
    MDP0000812154 42 RGNITLEEQLLILELHSRWGNR-WSKIAQHLP-GRTDNEIKNYWRT 85
                     7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.63136IPR017930Myb domain
Gene3DG3DSA:1.10.10.608.1E-16243IPR009057Homeodomain-like
PfamPF002492.0E-8236IPR001005SANT/Myb domain
SuperFamilySSF466891.18E-22283IPR009057Homeodomain-like
CDDcd001675.78E-5236No hitNo description
SMARTSM007176.8238IPR001005SANT/Myb domain
PROSITE profilePS5129423.2463791IPR017930Myb domain
SMARTSM007171.3E-144189IPR001005SANT/Myb domain
PfamPF002494.9E-154285IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.0E-234490IPR009057Homeodomain-like
CDDcd001671.28E-76285No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 297 aa     Download sequence    Send to blast
MNYIANHGEG RWNSLAGCAG LKRTGKSCRL RWLNYLRPDV RRGNITLEEQ LLILELHSRW  60
GNRWSKIAQH LPGRTDNEIK NYWRTRVQKH AKQLKCDVNS KQFKDTMRYI WMPRLVERIQ  120
AAAAASTTTN ATATDSSVAA PATSHHFSNN FQSSAQMLLQ PSHHHHFGVS SHSQLTPSYN  180
TPENSSTAAS SDSFGTQVSP VSDLTDYYTP TTAAAISVNN NPTPDNSYFV QDNHQVGNYD  240
NYSGSLGNQG LGLEHFQTMD EQNNNYQWGT VEGGDISDNW WNVEDMWFLQ QHLSSI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C9e-1818339120MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFR8285401e-131FR828540.1 Rosa rugosa mRNA for putative MYB transcription factor (myb7 gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008340570.10.0PREDICTED: transcription factor MYB108
SwissprotQ9LDE16e-83MY108_ARATH; Transcription factor MYB108
TrEMBLM5XQV51e-143M5XQV5_PRUPE; Uncharacterized protein
STRINGPOPTR_0008s10080.11e-115(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF87534125
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49620.14e-79myb domain protein 78